PSB9_HUMAN P28065
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28065
Recommended name：Proteasome subunit beta type-9
EC number：EC:3.4.25.1
Alternative names：(Low molecular mass protein 2) (Macropain chain 7) (Multicatalytic endopeptidase complex chain 7) (Proteasome chain 7) (Proteasome subunit beta-1i) (Really interesting new gene 12 protein)
Cleaved into：
GeneID：5698
Gene names (primary )：PSMB9
Gene names (synonym )：LMP2 PSMB6i RING12
Gene names (ORF )：
Length：219
Mass：23264
Sequence：MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Tissue specificity：
Induction：Up-regulated by interferon gamma (at protein level). Up-regulated by IRF1. Up-regulated by tumor necrosis factor-alpha (at protein level). Up-regulated by tetrodotoxin (TTX) in glial cells. Up-regulated in Crohn's bowel disease (CD). Up-regulated by heat shock treatment. Up-regulated by CD40L via the NFKB1 pathway in cancer cells. {ECO:0000269|PubMed:11493458, ECO:0000269|PubMed:15501285, ECO:0000269|PubMed:15907481, ECO:0000269|PubMed:17142736, ECO:0000269|PubMed:17262812, ECO:0000269|PubMed:18694960, ECO:0000269|PubMed:8663318}.
Developmental stage：Highly expressed in immature dendritic cells (at protein level). {ECO:0000269|PubMed:11717192}.
Protein families：Peptidase T1B family