PO5F1_HUMAN Q01860
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01860
Recommended name：POU domain, class 5, transcription factor 1
EC number：
Alternative names：(Octamer-binding protein 3) (Oct-3) (Octamer-binding protein 4) (Oct-4) (Octamer-binding transcription factor 3) (OTF-3)
Cleaved into：
GeneID：5460
Gene names (primary )：POU5F1
Gene names (synonym )：OCT3 OCT4 OTF3
Gene names (ORF )：
Length：360
Mass：38571
Sequence：MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Tissue specificity：Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues. {ECO:0000269|PubMed:1408763, ECO:0000269|PubMed:7908264}.
Induction：Transcriptional activity is positively regulated by PKM. {ECO:0000269|PubMed:18191611}.
Developmental stage：Highly expressed in undifferentiated embryonic stem cells and expression decreases gradually after embryoid body (EB) formation. {ECO:0000269|PubMed:19274063}.
Protein families：POU transcription factor family, Class-5 subfamily