PROK1_HUMAN P58294
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P58294
Recommended name：Prokineticin-1
EC number：
Alternative names：(Endocrine-gland-derived vascular endothelial growth factor) (EG-VEGF) (Mambakine)
Cleaved into：
GeneID：84432
Gene names (primary )：PROK1
Gene names (synonym )：
Gene names (ORF )：UNQ600/PRO1186
Length：105
Mass：11715
Sequence：MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Tissue specificity：Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testis, adrenal and placenta. {ECO:0000269|PubMed:11528470, ECO:0000269|PubMed:15292351, ECO:0000269|PubMed:18339712}.
Induction：
Developmental stage：In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis.
Protein families：AVIT (prokineticin) family