TKNK_HUMAN Q9UHF0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UHF0
Recommended name：Tachykinin-3
EC number：
Alternative names：(ZNEUROK1)
Cleaved into：Neurokinin-B (NKB) (Neuromedin-K)
GeneID：6866
Gene names (primary )：TAC3
Gene names (synonym )：NKNB
Gene names (ORF )：UNQ585/PRO1155
Length：121
Mass：13438
Sequence：MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Tissue specificity：
Induction：
Developmental stage：In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia.
Protein families：Tachykinin family