PDGFC_HUMAN Q9NRA1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NRA1
Recommended name：Platelet-derived growth factor C
EC number：
Alternative names：(PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E)
Cleaved into：Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)
GeneID：56034
Gene names (primary )：PDGFC
Gene names (synonym )：SCDGF
Gene names (ORF )：UNQ174/PRO200
Length：345
Mass：39029
Sequence：MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Tissue specificity：Expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Expressed in medulloblastoma. In the kidney, constitutively expressed in parietal epithelial cells of Bowman's capsule, tubular epithelial cells and in arterial endothelial cells (at protein level). Highly expressed in the platelets, prostate, testis and uterus. Higher expression is observed in uterine leiomyomata. Weaker expression in the spleen, thymus, heart, pancreas, liver, ovary cells and small intestine, and negligible expression in the colon and peripheral blood leukocytes. {ECO:0000269|PubMed:10806482, ECO:0000269|PubMed:11004490, ECO:0000269|PubMed:11297552, ECO:0000269|PubMed:11342471, ECO:0000269|PubMed:11854040, ECO:0000269|PubMed:12176024, ECO:0000269|PubMed:15061151, ECO:0000269|PubMed:17482170, ECO:0000269|PubMed:18055825}.
Induction：Up-regulated by EWS-FLI1 chimeric transcription factor in tumor derived cells. Up-regulated in podocytes and interstitial cells after injury/activation of these cells. FGF2 activates PDGFC transcription via EGR1. Up-regulated by TGFB1 in concert with FGF2. {ECO:0000269|PubMed:11313995, ECO:0000269|PubMed:12707385, ECO:0000269|PubMed:15247255, ECO:0000269|PubMed:16439802}.
Developmental stage：In the fetal kidney, detected in the developing mesangium, ureteric bud epithelium and the undifferentiated mesenchyme (at protein level). {ECO:0000269|PubMed:12707385}.
Protein families：PDGF/VEGF growth factor family