SPB3_HUMAN P29508
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29508
Recommended name：Serpin B3
EC number：
Alternative names：(Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1)
Cleaved into：
GeneID：6317
Gene names (primary )：SERPINB3
Gene names (synonym )：SCCA SCCA1
Gene names (ORF )：
Length：390
Mass：44565
Sequence：MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Tissue specificity：Squamous cells. Expressed in some hepatocellular carcinoma (at protein level). {ECO:0000269|PubMed:14970861}.
Induction：Strongly up-regulated in the upper epidermis of sun-exposed skin. {ECO:0000269|PubMed:19166818}.
Developmental stage：Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
Protein families：Serpin family, Ov-serpin subfamily