PRG2_HUMAN P13727
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13727
Recommended name：Bone marrow proteoglycan
EC number：
Alternative names：(BMPG) (Proteoglycan 2)
Cleaved into：Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)
GeneID：5553
Gene names (primary )：PRG2
Gene names (synonym )：MBP
Gene names (ORF )：
Length：222
Mass：25206
Sequence：MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Tissue specificity：High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon. {ECO:0000269|PubMed:10491647, ECO:0000269|PubMed:7526035}.
Induction：
Developmental stage：Levels of the proform increase in serum and placenta during pregnancy. {ECO:0000269|PubMed:10491647, ECO:0000269|PubMed:7539791}.
Protein families：