ANGI_HUMAN   P03950


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P03950

Recommended name:Angiogenin

EC number:EC:3.1.27.-

Alternative names:(Ribonuclease 5) (RNase 5)

Cleaved into:

GeneID:283

Gene names  (primary ):ANG

Gene names  (synonym ):RNASE5

Gene names  (ORF ):

Length:147

Mass:16550

Sequence:MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Tissue specificity:Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons. {ECO:0000269|PubMed:17886298, ECO:0000269|PubMed:2440105}.

Induction:

Developmental stage:Low level expression in the developing fetus, increased in the neonate, and maximal in the adult.

Protein families:Pancreatic ribonuclease family


   💬 WhatsApp