CI116_HUMAN   Q5BN46


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BN46

Recommended name:UPF0691 protein C9orf116

EC number:

Alternative names:(p53-induced expression in RB-null cells protein 1) (Pierce1)

Cleaved into:

GeneID:138162

Gene names  (primary ):C9orf116

Gene names  (synonym ):

Gene names  (ORF ):

Length:136

Mass:15260

Sequence:MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD

Tissue specificity:

Induction:

Developmental stage:May be up-regulated during progression from G1 to S phase of the cell cycle. Maximal expression in S or G2 phase. {ECO:0000269|PubMed:18182857}.

Protein families:UPF0691 family


   💬 WhatsApp