FBP12_HUMAN A6NFH5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6NFH5
Recommended name：Fatty acid-binding protein 12
EC number：
Alternative names：
Cleaved into：
GeneID：646486
Gene names (primary )：FABP12
Gene names (synonym )：
Gene names (ORF )：
Length：140
Mass：15565
Sequence：MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS
Tissue specificity：Expressed in a number of retinoblastoma cell lines. {ECO:0000269|PubMed:18786628}.
Induction：
Developmental stage：Not detected in fetal tissues. {ECO:0000269|PubMed:18786628}.
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family