MCHL2_HUMAN   Q9BQD1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BQD1

Recommended name:Putative pro-MCH-like protein 2

EC number:

Alternative names:(Pro-melanin-concentrating hormone-like protein 2)

Cleaved into:

GeneID:

Gene names  (primary ):PMCHL2

Gene names  (synonym ):

Gene names  (ORF ):

Length:86

Mass:9856

Sequence:MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Tissue specificity:Expressed in testis but not in brain.

Induction:

Developmental stage:Not expressed during brain development. {ECO:0000269|PubMed:11070051}.

Protein families:Melanin-concentrating hormone family


   💬 WhatsApp