CAH10_HUMAN   Q9NS85


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NS85

Recommended name:Carbonic anhydrase-related protein 10

EC number:

Alternative names:(Carbonic anhydrase-related protein X) (CA-RP X) (CARP X) (Cerebral protein 15)

Cleaved into:

GeneID:56934

Gene names  (primary ):CA10

Gene names  (synonym ):

Gene names  (ORF ):hucep-15 UNQ533/PRO1076

Length:328

Mass:37563

Sequence:MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

Tissue specificity:Strong expression in brain and central nervous system. {ECO:0000269|PubMed:11311946}.

Induction:

Developmental stage:Not expressed in fetal brain.

Protein families:Alpha-carbonic anhydrase family


   💬 WhatsApp