S10A2_HUMAN P29034
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29034
Recommended name：Protein S100-A2
EC number：
Alternative names：(CAN19) (Protein S-100L) (S100 calcium-binding protein A2)
Cleaved into：
GeneID：6273
Gene names (primary )：S100A2
Gene names (synonym )：S100L
Gene names (ORF )：
Length：98
Mass：11117
Sequence：MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Tissue specificity：A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes. {ECO:0000269|PubMed:1372446}.
Induction：By growth factors in early G1 phase and probably by cell-cycle regulation in S phase. DNA methylation probably plays a direct negative role in suppressing S100L gene expression in tumor cells. {ECO:0000269|PubMed:1372446, ECO:0000269|PubMed:9481475}.
Developmental stage：Preferentially expressed in normal human mammary epithelial cells as opposed to tumor-derived ones. The level of S100L was shown to correlate inversely with tumor progression. {ECO:0000269|PubMed:9481475}.
Protein families：S-100 family