HESX1_HUMAN   Q9UBX0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UBX0

Recommended name:Homeobox expressed in ES cells 1

EC number:

Alternative names:(Homeobox protein ANF) (hAnf)

Cleaved into:

GeneID:8820

Gene names  (primary ):HESX1

Gene names  (synonym ):HANF

Gene names  (ORF ):

Length:185

Mass:21409

Sequence:MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE

Tissue specificity:

Induction:

Developmental stage:Strongly expressed in Rathke pouch in seven-week-old embryo.

Protein families:ANF homeobox family


   💬 WhatsApp