RSLBB_HUMAN   Q9BPW5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BPW5

Recommended name:Ras-like protein family member 11B

EC number:EC:3.6.5.2

Alternative names:

Cleaved into:

GeneID:65997

Gene names  (primary ):RASL11B

Gene names  (synonym ):

Gene names  (ORF ):

Length:248

Mass:27508

Sequence:MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV

Tissue specificity:Widely expressed with highest levels in placenta and primary macrophages. {ECO:0000269|PubMed:17628721}.

Induction:By TGFB1. {ECO:0000269|PubMed:17628721}.

Developmental stage:Up-regulated during development of primary monocytes into macrophages. {ECO:0000269|PubMed:17628721}.

Protein families:Small GTPase superfamily, Ras family


   💬 WhatsApp