TMM64_MOUSE   Q3U145


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3U145

Recommended name:Transmembrane protein 64

EC number:

Alternative names:

Cleaved into:

GeneID:100201

Gene names  (primary ):Tmem64

Gene names  (synonym ):

Gene names  (ORF ):

Length:381

Mass:39815

Sequence:MRNPGGSLPHTLPRALQHAGRTGVVEQPGRWAPERTAGGDRSEDRLPRGGGASAAAAAAAAAASGALLGAYLERHGLPAASDLPAPAGALAGGPGSGGGVVVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQNSDKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLMASSAGLLPTQLLNSYLGTTLRTMEDVIAEQSLSGYFVFCLQIVISIGLMFYVVHRAQVELNAAIVACEMELKTSLVKGNQSDPSGSSFYNKRTLTFSGGGINIV

Tissue specificity:Liver, testis, kidney and muscle. {ECO:0000269|PubMed:23395171}.

Induction:

Developmental stage:

Protein families:TVP38/TMEM64 family


   💬 WhatsApp