MIEN1_MOUSE   Q9CQ86


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ86

Recommended name:Migration and invasion enhancer 1

EC number:

Alternative names:

Cleaved into:

GeneID:103742

Gene names  (primary ):Mien1

Gene names  (synonym ):Rdx12

Gene names  (ORF ):

Length:115

Mass:12295

Sequence:MSGEPAPVSVVPPPGEVEAGSGVHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITNSRPPCVIL

Tissue specificity:Widely expressed with highest levels in kidney followed by brain and testis. {ECO:0000269|PubMed:17503775}.

Induction:

Developmental stage:

Protein families:SelWTH family


   💬 WhatsApp