DNAL1_MOUSE Q05A62
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q05A62
Recommended name：Dynein light chain 1, axonemal
EC number：
Alternative names：
Cleaved into：
GeneID：105000
Gene names (primary )：Dnal1
Gene names (synonym )：Dnalc1
Gene names (ORF )：
Length：190
Mass：21465
Sequence：MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES
Tissue specificity：Expressed in the respiratory epithelium of the upper airways and the ependymal cells lining the brain ventricles. {ECO:0000269|PubMed:15845866}.
Induction：
Developmental stage：
Protein families：Dynein light chain LC1-type family