DLX3_MOUSE Q64205
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64205
Recommended name：Homeobox protein DLX-3
EC number：
Alternative names：
Cleaved into：
GeneID：13393
Gene names (primary )：Dlx3
Gene names (synonym )：
Gene names (ORF )：
Length：287
Mass：31791
Sequence：MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESTVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGGSYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARNPLPPPLPYSASPNYLDDPTNSWYHTQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Tissue specificity：Not expressed in the central nervous system. Expressed in a highly restricted region of the branchial arches. In later development, expressed in the developing middle and inner ear, teeth and whisker follicles.
Induction：
Developmental stage：
Protein families：Distal-less homeobox family