HGS_MOUSE   Q99LI8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99LI8

Recommended name:Hepatocyte growth factor-regulated tyrosine kinase substrate

EC number:

Alternative names:

Cleaved into:

GeneID:15239

Gene names  (primary ):Hgs

Gene names  (synonym ):Hrs

Gene names  (ORF ):

Length:775

Mass:86015

Sequence:MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPATFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPTGAPGAQAAPQAQAGPTTSPAYSSYQPTPTPGYQSVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTALPGQDASLPAQQPYIPGQQPLYQQMAPSTGPPQQQPPVAQPAPTQGPPAQGSEAQLISFD

Tissue specificity:Ubiquitous expression in adult and fetal tissues with higher expression in testis. {ECO:0000269|PubMed:7565774, ECO:0000269|PubMed:9630564}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp