HXB13_MOUSE P70321
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70321
Recommended name：Homeobox protein Hox-B13
EC number：
Alternative names：
Cleaved into：
GeneID：15408
Gene names (primary )：Hoxb13
Gene names (synonym )：
Gene names (ORF )：
Length：286
Mass：30963
Sequence：MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYAPLDLPGSAEPPKQCHPCPGVPQGASPAPVPYGYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFYPGYPGPYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSVQHPPPDGCAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKTSTTP
Tissue specificity：Exhibits both spatial and temporal colinearity within the main body axis. At E12.5, is detected in hindgut, urogenital tract, spinal chord and tailbud. Not detected in secondary axes such as the limb and the genital tubercule.
Induction：
Developmental stage：
Protein families：Abd-B homeobox family