HXC13_MOUSE P50207
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50207
Recommended name:Homeobox protein Hox-C13
EC number:
Alternative names:
Cleaved into:
GeneID:15422
Gene names (primary ):Hoxc13
Gene names (synonym ):Hoxc-13
Gene names (ORF ):
Length:328
Mass:35193
Sequence:MTTSLLLHPRWPESLMYVYEDSAAESGSGGGGGGGGAGGAGGGCSGASPGKAPSMDGLGGSCPASHCRDLLPHPVLARPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST
Tissue specificity:Expressed in differentiating keratinocytes. In the hair follicle lower matrix, expressed in all 3 hair shaft-forming compartments, i.e. cuticle, cortex and medulla. Expression stops sharply at the boundary with the germinal matrix compartment. {ECO:0000269|PubMed:11290294, ECO:0000269|PubMed:16835220}.
Induction:
Developmental stage:
Protein families:Abd-B homeobox family