KR121_MOUSE Q9Z287
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z287
Recommended name：Keratin-associated protein 12-1
EC number：
Alternative names：
Cleaved into：
GeneID：16694
Gene names (primary )：Krtap12-1
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：13119
Sequence：MCHTSCSSGCQPSCCVSSSCQPSCCVSSPCQASCFVSSPCQPSCCVSSSCQSACCRPAICIPVRYQVACCVPVSCGPTVCMAPSCQSSVCVPVSCRPVCVTSSCQSSGCCQPSCPTLVCKPVTCSNPSCC
Tissue specificity：Expressed only in the head and back skin of a 3 day old mouse. Not expressed in adult skin. {ECO:0000269|PubMed:9878246}.
Induction：
Developmental stage：
Protein families：KRTAP type 12 family