TYB10_MOUSE   Q6ZWY8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZWY8

Recommended name:Thymosin beta-10

EC number:

Alternative names:

Cleaved into:

GeneID:19240

Gene names  (primary ):Tmsb10

Gene names  (synonym ):Ptmb10

Gene names  (ORF ):

Length:44

Mass:5026

Sequence:MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Thymosin beta family


   💬 WhatsApp