S2543_MOUSE   A2A3V2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2A3V2

Recommended name:Solute carrier family 25 member 43

EC number:

Alternative names:

Cleaved into:

GeneID:194744

Gene names  (primary ):Slc25a43

Gene names  (synonym ):Gm8

Gene names  (ORF ):

Length:341

Mass:38064

Sequence:MATWRRDGRLTGSQRLLCAGLAGAFSLSLTAPLELATVLAQVGKVQSHSLGLWATGRRVWLSEGPRALWKGNGVACLRLFPCSMVQLAAYRKFVVLFMDDLGRISQWSSIVTGSLAGMVSTIVTYPTDLIKTRLMVQNVLEPSYRGLIHAFSTIYQQEGFLALYRGVSLTVLGAVPFSAGSLLVYMNLEKVWNGPRDRFSHLQNFANVCVAAAVSQTLSFPFDTVKRKMQAQSPYLPHYGGVDVHFSGAADCFRQIVKTQGVLGLWNGLTANLLKVVPYFGVMFSMFEFCKRIFLYQNGYTLSPLTYKLTPGVDQSLKPQELRELKKFFKRRKLHSKTPPW

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp