SECR_MOUSE   Q08535


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q08535

Recommended name:Secretin

EC number:

Alternative names:

Cleaved into:

GeneID:20287

Gene names  (primary ):Sct

Gene names  (synonym ):

Gene names  (ORF ):

Length:133

Mass:14914

Sequence:MEPPLPTPMLLLLLLLLSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDTENIPENSLARSKPLEDQLCLLWSNTQTLQDWLLPRLSLDGSLSLWLPPGPRSAVDRSEWTETTRPPR

Tissue specificity:Highly expressed in the intestine (PubMed:18534766). Also expressed in the hippocampus, cerebellum and the brain stem in adult mouse brain (PubMed:18534766). In the hippocampus, expressed in the dentate gyrus, the hilus and the molecular layer (PubMed:18534766). {ECO:0000269|PubMed:18534766}.

Induction:

Developmental stage:

Protein families:Glucagon family


   💬 WhatsApp