NDUF8_MOUSE   A2AMZ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2AMZ4

Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8

EC number:

Alternative names:

Cleaved into:

GeneID:208501

Gene names  (primary ):Ndufaf8

Gene names  (synonym ):

Gene names  (ORF ):

Length:74

Mass:7785

Sequence:MSVNGAVWGRVRSRFRAFPEHLAACGAEASAYGKCVQASTAPGGRLSKDLCVREFEALRSCFAAAAKKTMMGGS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp