CR025_MOUSE   Q8BH50


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BH50

Recommended name:Uncharacterized protein C18orf25 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:212163

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:245

Mass:26446

Sequence:MKMEEAVGKVEELIESAAPPKASEQETAKEEDGSVELESQVQKDGVADSTVLSSMPCLLMELRRDSSESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSVEENEPSQAETTVEGDTSGVSGATVGRKSRRSRSESETSTMAAKKNRQSSDKQNGRVTKVKGHRSQKHKERIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTSSSDDDDEVSGSSKTITAEIPGRGCFLN

Tissue specificity:Detected in brain, liver, lung, kidney, heart, spleen, skeletal muscle and spinal cord. {ECO:0000269|PubMed:15722956}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp