TEST2_MOUSE Q80UB0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80UB0
Recommended name：Testin-2 [Cleaved into: Testin-1]
EC number：
Alternative names：
Cleaved into：
GeneID：214639
Gene names (primary )：
Gene names (synonym )：
Gene names (ORF )：
Length：333
Mass：38090
Sequence：MIAVLFLAILCLEIDSTAPTLDPSLDVQWNEWRTKHGKAYNVNEERLRRAVWEKNFKMIELHNWEYLEGKHDFTMTMNAFGDLTNTEFVKMMTGFRRQKIKRMHVFQDHQFLYVPKYVDWRMLGYVTPVKNQGYCASSWAFSATGSLEGQMFKKTGRLVPLSEQNLLDCMGSNVTHDCSGGFMQNAFQYVKDNGGLATEESYPYIGPGRKCRYHAENSAANVRDFVQIPGREEALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSYWLVKNSWGEEWGMKGYIKIAKDWNNHCGIATLATYPIV
Tissue specificity：Expressed in testis and ovary. Low level in spleen, epididymis, kidney, and uterus. Expressed in primary cultures of Sertoli cells. {ECO:0000269|PubMed:12606342}.
Induction：
Developmental stage：
Protein families：Peptidase C1 family