P5I13_MOUSE Q5F267
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5F267
Recommended name：Tumor protein p53-inducible protein 13
EC number：
Alternative names：
Cleaved into：
GeneID：216964
Gene names (primary )：Tp53i13
Gene names (synonym )：Trp53i13
Gene names (ORF )：
Length：385
Mass：41766
Sequence：MVHPPPPPPRLLLVALVGLLSLREVVAEPAEEAGTPCPEGLWPVPPQVLPRVTYTQVSQGQAEGIAFFYHPCAHPWLKLQLALLAHLYVAKPTLIPDFSLTWDRPLVLTAWGTALELAWIEPAWVAHWLKRQRRRKQRKSVWFLSDNLFGPTPTMPASRRGKLCGRRCVQAPTLAFALRSWRPPGAQVTSRGSGRSSISVVKRRGLRAALGLQSTPPGLRVSLASSQSLKAQQLTLGTSSVAPVSLTTGGPGGNGRSRTEAQMPSGQGNHGGCACPGQVSPAPRAAGPPRVARGPTPRTEEAAWAAMALTFLLVLLTLATLCTRLHRNFRRSESIYWGPTADSQDTVAALLKRRLPLPSRRIKRSRRRPLLPPTPDSGPDSESSD
Tissue specificity：
Induction：
Developmental stage：
Protein families：