TPPP2_MOUSE   Q0P5Y3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q0P5Y3

Recommended name:Tubulin polymerization-promoting protein family member 2

EC number:

Alternative names:

Cleaved into:

GeneID:219038

Gene names  (primary ):Tppp2

Gene names  (synonym ):Gm77

Gene names  (ORF ):

Length:170

Mass:18681

Sequence:MASEAERTFHRFAVFGESSSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMKELGQKRFKGKNPDEALQGVFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFDESGKGKGIEGREETTDNSGYVSGYKGAGTYDKKNQ

Tissue specificity:Only expressed in male reproductive organs, including testis (PubMed:30680919). Expressed in elongating spermatids at stages IV-VIII of the seminiferous epithelial cycle in testis and in mature sperm in the epididymis (PubMed:30680919). {ECO:0000269|PubMed:30680919}.

Induction:

Developmental stage:

Protein families:TPPP family


   💬 WhatsApp