RTP2_MOUSE   Q80ZI2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80ZI2

Recommended name:Receptor-transporting protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:224055

Gene names  (primary ):Rtp2

Gene names  (synonym ):Gm605

Gene names  (ORF ):

Length:223

Mass:25900

Sequence:MSTSLTTCEWKKVFYEKMEVAKPADSWELIIDPTLKPNELGPGWKQYLEQHASGRFHCSWCWHTWQSANVVILFHMHLDRAQRVGSVRMRVFKQLCYQCGTSRLDESSMLEENIEGLVDNLITSLREQCYDEDGGQYRIHVASRPDSGLHRSEFCEACQEGIVHWKPSEKLLEEDAAYTDASKKKGQAGFISSFFSFRWCLFWGTLCLVIVYLQFFRGRSGFL

Tissue specificity:Predominantly expressed in olfactory and vomeronasal organs, in mature olfactory sensory neurons. {ECO:0000269|PubMed:15550249}.

Induction:

Developmental stage:

Protein families:TMEM7 family


   💬 WhatsApp