CLD17_MOUSE Q8BXA6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BXA6
Recommended name：Claudin-17
EC number：
Alternative names：
Cleaved into：
GeneID：239931
Gene names (primary )：Cldn17
Gene names (synonym )：
Gene names (ORF )：
Length：224
Mass：24653
Sequence：MAFYPLQIAGLVLGFFGLVGTIGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAVALALVALIIGICGMKQLQCTGSSERVKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYDPTVHAGQKRELGGALFLGWATAAVLFIGGGLLCGYCCCNRKERWHRYPVPAYRVPQKDNQRNVTVPRKSSTSYV
Tissue specificity：Expressed at high levels in the kidney and at mucher lower levels in the brain. In the kidney, expression gradually decreases from the proximal tubule downstream to the distal convoluted tubule. Expressed in the thin ascending limb of Henle's loop, as well as in the thick ascending limb of Henle's loop. In the distal convoluted tubules, expressed only in a few tubules. Not detected in the collecting duct. In the brain, expressed in blood vessels (at protein level). {ECO:0000269|PubMed:22402829}.
Induction：
Developmental stage：
Protein families：Claudin family