MCPH1_MOUSE   Q7TT79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TT79

Recommended name:Microcephalin

EC number:

Alternative names:

Cleaved into:

GeneID:244329

Gene names  (primary ):Mcph1

Gene names  (synonym ):

Gene names  (ORF ):

Length:822

Mass:90373

Sequence:MEASGGVGGAFLKDVVAYVEVWSSKGTENYSRTFAKQLEDMGATVSKTLNKQVTHVIFKDGYQSTWDKAQKTGAKLVSVLWVEKCRMAGALVDESLFPAVNTDEHLPNLSRKKHKCMQPKDFILKTPENDKRLQKKFEKMAEELQRQKAALDDDVPVLLFESPRSLVYSSPVNVMKRRLQDMKEKRENLSPTSSQMLEQSQQNPCVSLFETSLNISHQPLSSDESFASGSHSSFGDSCGDQERKLGRSANEMTTVTCPSSPVLRASSFYGSASPNHLRQPRPQKAPDSPSKESINCQKDATGAVADSERKQAAGVSQGVPDEKLCLSPTMSIIEEHQVRLGPKNSSAKRKRAADLGSSPKGKLKKRYKRKSALAIQLFKSDQSPPSTIRLIPGTPDVEASSYEDYFSPDNLKERNSERLPPEAQQLASPSLFHCRGLSKWERRNMLEMCDFTCIGEKHRSISSISDLISKSASSLEKPVKEEVNTASTCLLLVETSANDSPGLCSQPGPQLRDDTGPEGSSHPDTLSSSAHHITPLKGNSTETRDPGDGKGSPKEGSTPPASASPEDEVHICNLSLGEDCNVEKSVEEKENIATGYSESVKNGPGRPDPSDSSCTGLVRPQQKPKKSEKEEKPTRTLVMTSMPSEKQTLIIQVVSTLKGFSFAPEVCETTTHVLVGKSARTLNVLMGIARGCWILSYEWVLLSLELGHWISEEPFELSETFPAAPICRLERHLSTQQYQGTLFANQPKMFIAPASSPPRAKLCELVLLCGGQVSPAPQLASLIIGPYKGKKKARIQYLSEKWVLDSITQHKICDFNNYQLLQ

Tissue specificity:High levels of expression are found in the developing forebrain and, in particular, in the walls of the lateral ventricles. {ECO:0000269|PubMed:12046007}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp