PONL1_MOUSE Q6P3Y9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P3Y9
Recommended name：Podocan-like protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：244550
Gene names (primary )：Podnl1
Gene names (synonym )：Gm506
Gene names (ORF )：
Length：559
Mass：62519
Sequence：MRPQELLLLLLMLKWSLAHTEDPAFPHLGDSSQPLPRPCPWRCSCPRDDTVDCAGLDLRIFPDNITRAARHLSLQNNQLRELPYNELSRLSGLRTLDLHSNLITSEGLPDEAFESLNQLENFYVAHNKLSVAPQFLPRSLRVADLAANEVVEIFPLTFGEKPALRSVYLHNNRLRNTGLPPNTFHGSEVITTLSLSSNQLSYLPPSLPASLERLHLQNNLISKVPRGALSLQTHLRELYLQHNQLTDSGLDATTFSKLSSLEYLDLSHNQLATVPEGLPGTLTILHLGRNCIRHVEAVRLHKARGLRYLLLQHNKLGASALPKGTLRPLRALHTLHLYGNKLERVPPALPRHLQALVMPHNHVAALGARDLVSARALAELNLAYNSLASAHVHPSAFRRLRALRSLDLAGNQLTRLPEGLPASLRSLRLQRNQLRTLEPEQLAGLNKLRELNLAHNRLRVGDIGPGTWHELQALKVLDLSHNELSFVPPDLPEALEELYLQANRISHVGPEAFLSTPHLRALFLRANRLHMTSIRAEALQGLTHLRVVDTAENPEQVLV
Tissue specificity：Detected in bone where it is expressed in osteoblasts and newly formed bone matrix (at protein level). Also expressed weakly in osteoclasts (at protein level). Expressed strongly in calvaria, lung and femur, and weakly in kidney. {ECO:0000269|PubMed:21672516}.
Induction：
Developmental stage：
Protein families：Small leucine-rich proteoglycan (SLRP) family, SLRP class V subfamily