FGD2_MOUSE   Q8BY35


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BY35

Recommended name:FYVE, RhoGEF and PH domain-containing protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:26382

Gene names  (primary ):Fgd2

Gene names  (synonym ):

Gene names  (ORF ):

Length:655

Mass:74634

Sequence:MERACEKQDSVCNLVAVFENNRTPGEAPGSHSLEDQPHSPEHQLSLSPEPWEAPPVKEALKSEFRPVSRTYLSSLKNKLSSGAWRRSCQPGVSPGPETQEPEEKRVVRELLETEQAYVARLHLLDQVFFQELLREAGRSKAFPEDVVKLIFSNISSIYRFHAQFFLPELQRRVDDWAATPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWMDKSQPFQEVVTRIQCSEASSSLTLQHHMLEPVQRIPRYELLLKEYVQKLPAQAPDLEDAQRALDMIFSAAQHSNAAIAEMERLQGLWDVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQRTLELQARSRDEMVSWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNVLPQGKEDKRRGILEKEASAAPEQSLVCSFLQLIGDKCSRSLPRSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISGPQGDPRVFQLQQSGQQYTFKAESVELQGRWVTAIKRAASGRTPEGPDEEDVSD

Tissue specificity:Lymph node, spleen, B-lymphocytes and macrophages (at protein level). Expressed at high levels in lymph node, spleen, B-lymphocytes and bone marrow macrophages. Expressed at lower levels in mature bone marrow dendritic cells. In both immature and mature B-cells, expression is down-regulated by prior B-cell receptor signaling. Expression remains high in resting B and memory cells but declines upon differentiation into plasma cells. {ECO:0000269|PubMed:10458911, ECO:0000269|Ref.2}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp