ELL3_MOUSE   Q80VR2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80VR2

Recommended name:RNA polymerase II elongation factor ELL3

EC number:

Alternative names:

Cleaved into:

GeneID:269344

Gene names  (primary ):Ell3

Gene names  (synonym ):

Gene names  (ORF ):

Length:395

Mass:44762

Sequence:MEGTQEALSGKMRLLFTPAARTSLLMLRLNEAALRALQECQQQQVRPVIAFQGHRGYLRFPGPGWSCLFSFIVSQCGQEGTNGGLDLVYQRLGRSGPNCLHCLGSLRERLTIWAAMDTIPAPLLAQEHLTEGTRESESWQDTGDEPEGHPQLAPDEVSDPLASHHEQSLPGSSSEPMAQWEMRNHTYLPSREPDQSLLSPASQKRLDKKRSAPITTEEPEEKRLRALPLASSPLQGLANQDSQEGEDWGQDEDEEGDEDGDSRLEQSLSAPSASESPSPEEVPDYLLQYRAIHSTEQQQAYEQDFETDYAEYRILHARVGAASQRFTELGAEIKRLQRGTPEHKVLEDKIVQEYKKFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEEKNRGS

Tissue specificity:Actively expressed in embryonic stem cells (ES cells), while it is weakly expressed in differentiated cells. {ECO:0000269|PubMed:22768269}.

Induction:

Developmental stage:

Protein families:ELL/occludin family


   💬 WhatsApp