SPIB_MOUSE O35906
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35906
Recommended name：Transcription factor Spi-B
EC number：
Alternative names：
Cleaved into：
GeneID：272382
Gene names (primary )：Spib
Gene names (synonym )：
Gene names (ORF )：
Length：267
Mass：29365
Sequence：MLALEAAQLDGPHLSCLYPEGVFYDLDSCKPFSYPDSDGGLDSTWGWTEAPPAPAIAPYEAFDPATAAFSHSQTVQLCYSHGPNPSTYSPMGTLDPAPSLEAPGPGLQVYPPEDFTSQTLGSLAYAPYPSPVLSEEEDIMLDSPALEVSDSESDEALLAGSEGRGSEAGARKKLRLYQFLLGLLLRGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPASRHV
Tissue specificity：Expressed in the medulla of the thymus, the spleen and germinal centers of the lymph nodes. Expressed in B-cells and T-cells, expression increases during B-cell maturation and decreases during T-cell maturation. {ECO:0000269|PubMed:8691135}.
Induction：
Developmental stage：
Protein families：ETS family