LYPD6_MOUSE   Q8BPP5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BPP5

Recommended name:Ly6/PLAUR domain-containing protein 6

EC number:

Alternative names:

Cleaved into:

GeneID:320343

Gene names  (primary ):Lypd6

Gene names  (synonym ):

Gene names  (ORF ):

Length:171

Mass:19065

Sequence:MEPSPALAWLLLLSLVADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRDTRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGYKICTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPHCVSVIVSCLWVWLGLTL

Tissue specificity:Highly expressed in the brain and spinal cord, as well as dorsal root and trigeminal ganglia. {ECO:0000269|PubMed:19403274}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp