FPRS6_MOUSE Q3SXG2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3SXG2
Recommended name:Formyl peptide receptor-related sequence 6
EC number:
Alternative names:
Cleaved into:
GeneID:321020
Gene names (primary ):Fpr-rs6
Gene names (synonym ):
Gene names (ORF ):
Length:339
Mass:38154
Sequence:MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVTTICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIAMDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNFESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPLRVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFLGQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL
Tissue specificity:Expressed exclusively in vomeronasal tissue (PubMed:19387439 and PubMed:19497865). Expressed in 1.2 % of a subset of sensory neurons located in the apical layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed in brain, spleen, skeletal muscle and at high level in testis (PubMed:12459252). {ECO:0000269|PubMed:12459252, ECO:0000269|PubMed:19387439, ECO:0000269|PubMed:19497865}.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family