VMO1_MOUSE   Q5SXG7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5SXG7

Recommended name:Vitelline membrane outer layer protein 1 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:327956

Gene names  (primary ):Vmo1

Gene names  (synonym ):Gm741

Gene names  (ORF ):

Length:201

Mass:21957

Sequence:MELQAGARLLLLLGVMCYGHAQIQVHVEPRYASIVDVTNGGTWGDWAWPEMCPDGYFASGFSVKVEPPQGIPGDDTALNGIRLHCTRGNSQKNTHVVESQSGSWGSWSEPLWCPGTSFLVAFCLRVEPFTFPGDNTGVNNVRFRCSDGVELEGPGLNWGDYGEWSNSCPKGVCGLQTKIQKPRGLRDDTALNDIRIFCCAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:VMO1 family


   💬 WhatsApp