ZCPW1_MOUSE   Q6IR42


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IR42

Recommended name:Zinc finger CW-type PWWP domain protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:381678

Gene names  (primary ):Zcwpw1

Gene names  (synonym ):Gm1053

Gene names  (ORF ):

Length:630

Mass:70569

Sequence:MMAALQTHKEYEKGTKKTFAPPTQKLHSEKPQPSSWKEDAPGTSSPEAETKPSLLKASLKKEQKPTTEHGPNRGQERKLKAQDQPAKKKGKERTLTSAEFEEIFQIVLQKSLQECLETSSCVQHIRPTKLDEEPGIVPPATDKKDADPEKVITPDTPKIASSLEEEVNSEMGTSKLGQPVTEPSKKKFNRLSLSKQKKKAEDEKMEKIQDGRECSLKEKQKIVIQDQSQIRGPQKEEESGFGHCVIWVQCSSPKCEKWRQLRGNIDPSVLPDDWSCDQNPDPNYNRCDIPEESWAGCESDVAYASYVPGSIIWAKQYGYPWWPGMIEADPDLGEYFLFASHLDSLPSKYHVTFFGETVSRAWIPVRMLKNFQELSLELVKKCKNKNSNQKLEAAIAMAHRAEQTSIQERVNLFGFWSRYNGADISEEGEDLTLCESNNPESCLEKEEKDLEEEKEEEEEKKDPTLPRPKPAKMQTKKPKSRGPAGGPDGTPKKKTAKKSLVSESTVPPVPTLGGKEEQGNSDLDHPVPKKKFKAPENKTSATNLSEEKEIKIVSKCPTPSAQHGACPLGKEGLVPHMPPTQEAASFPPDDDCSSDLDLEQLMEDIGEPEERGEMQQRGSSEEFLAALFEE

Tissue specificity:Testis (at protein level) (PubMed:31453335, PubMed:32352380, PubMed:32374261, PubMed:32744506). Expressed in thymus, brain, lung, ovary, oviduct and uterus (PubMed:31453335). {ECO:0000269|PubMed:31453335, ECO:0000269|PubMed:32352380, ECO:0000269|PubMed:32374261, ECO:0000269|PubMed:32744506}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp