AGR3_MOUSE   Q8R3W7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R3W7

Recommended name:Anterior gradient protein 3

EC number:

Alternative names:

Cleaved into:

GeneID:403205

Gene names  (primary ):Agr3

Gene names  (synonym ):

Gene names  (ORF ):

Length:165

Mass:19081

Sequence:MLHSALALCLLLITVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL

Tissue specificity:Expressed in the ciliated cells of the airway epithelium. Not detected in the mucous cells. {ECO:0000269|PubMed:25751668}.

Induction:

Developmental stage:

Protein families:AGR family


   💬 WhatsApp