GRCR1_MOUSE   Q50H32


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q50H32

Recommended name:Glutaredoxin domain-containing cysteine-rich protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:433899

Gene names  (primary ):Grxcr1

Gene names  (synonym ):pi

Gene names  (ORF ):

Length:290

Mass:32402

Sequence:MLRRETKPESDRPRKVRFRIASSHSGRVLKEVYEDGQAPGSLDSECASICAIDGLSDSEGQQNGHIGSEDNEQEKDQDNLLVLARTASEKAFGTRRVNILSKNGTVRGVKYKVSAGQALFNNLTKVLQQPSADLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGDYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDLLTKIERVQHPHECPSCGGFGFLPCSVCHGSKMSVFRNCFTDAFKALKCTACNENGLQRCKNCTC

Tissue specificity:In the inner ear, expressed predominantly in sensory hair cells and their stereocilia bundles with higher levels in outer hair cells (OHC) at P1 and in inner hair cells (IHC) at P5. At P1, expression is prominent in each row of stereocilia within bundles including immature shorter stereocilia. Expression is also observed in apical microvilli of sensory cells at P1 and in kinocilia at P1 and P5. In the adult, expression is localized throughout the length of the stereocilia of both OHC and IHC (at protein level). {ECO:0000269|PubMed:20137774}.

Induction:

Developmental stage:

Protein families:GRXCR1 family


   💬 WhatsApp