ARL6_MOUSE   O88848


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88848

Recommended name:ADP-ribosylation factor-like protein 6

EC number:

Alternative names:

Cleaved into:

GeneID:56297

Gene names  (primary ):Arl6

Gene names  (synonym ):Bbs3

Gene names  (ORF ):

Length:186

Mass:20959

Sequence:MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQDQIQAVKT

Tissue specificity:Most abundant in brain and kidney. Expressed in heart and eye. Isoform 2 is expressed only in the retina. {ECO:0000269|PubMed:20333246}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Arf family


   💬 WhatsApp