CLD15_MOUSE   Q9Z0S5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z0S5

Recommended name:Claudin-15

EC number:

Alternative names:

Cleaved into:

GeneID:60363

Gene names  (primary ):Cldn15

Gene names  (synonym ):

Gene names  (ORF ):

Length:227

Mass:24280

Sequence:MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNMDLSKKAKLLAIAGTLHILAGACGMVAISWYAVNITTDFFNPLYAGTKYELGPALYLGWSASLLSILGGICVFSTCCCSSKEEPATRAGLPYKPSTVVIPRATSDESDISFGKYGKNAYV

Tissue specificity:Detected in duodenum, jejunum and ileum. Detected on intestinal villi and crypts (at protein level). Ubiquitous. Detected in small intestine, colon, jejunum, heart, kidney and lung. {ECO:0000269|PubMed:16505581, ECO:0000269|PubMed:18242218, ECO:0000269|PubMed:20727355, ECO:0000269|PubMed:23089202}.

Induction:

Developmental stage:

Protein families:Claudin family


   💬 WhatsApp