EDD13_MOUSE   E9Q7F5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:E9Q7F5

Recommended name:Epididymal protein 13

EC number:

Alternative names:

Cleaved into:

GeneID:627821

Gene names  (primary ):Eddm13

Gene names  (synonym ):Epp13 Gm6792

Gene names  (ORF ):

Length:164

Mass:18665

Sequence:MCRLEPFLKRSLVVLLFLGLAEACVPREVAMEEKIKMLKGILGLMGRLSPDGFRQNIISSSKTPPLVTTPDKSEEEMKILKRILGLLSLQVLNEETSNCKEEVKPPPATTTVRGLVRTSGWNFLRCAYMVITFFFVSYNKGDWCYCRYCNPDLDLRDDPCCSFQ

Tissue specificity:Highly expressed in segments II-V of the caput epididymis. {ECO:0000269|PubMed:12920233}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp