DJC15_MOUSE Q78YY6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78YY6
Recommended name：DnaJ homolog subfamily C member 15
EC number：
Alternative names：
Cleaved into：
GeneID：66148
Gene names (primary )：Dnajc15
Gene names (synonym )：Dnajd1
Gene names (ORF )：
Length：149
Mass：15953
Sequence：MATGGGVTSREGLRYAEYLPPSAQRSDADIDHTAGRRLLAVGLGVAAVAFAGRYAFQIWKPLEQVITATARKISSPSFSSYYKGGFEQKMSKREASLILGVSPSAGKAKIRTAHKRIMILNHPDKGGSPYLASKINEAKDLLEASSKAN
Tissue specificity：Expressed at high levels in liver, heart, at moderate levels in kidney and, at very low levels, in lung (at protein level). High expression levels in testis. Highly expressed in CD8+ T-cells, but barely detectable in CD4+ T-cells (at protein level). Almost undetectable in B-cells. {ECO:0000269|PubMed:23530063}.
Induction：
Developmental stage：
Protein families：