SARCO_MOUSE   Q9CQD6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQD6

Recommended name:Sarcolipin

EC number:

Alternative names:

Cleaved into:

GeneID:66402

Gene names  (primary ):Sln

Gene names  (synonym ):

Gene names  (ORF ):

Length:31

Mass:3808

Sequence:MERSTQELFINFTVVLITVLLMWLLVRSYQY

Tissue specificity:Highly expressed in heart atrium, red gastrocnemius muscle and soleus. Detected at lower levels in the extensor digitorum longus muscle (at protein level). {ECO:0000269|PubMed:21697544}.

Induction:

Developmental stage:

Protein families:Sarcolipin family


   💬 WhatsApp