HEPC2_MOUSE Q80T19
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80T19
Recommended name：Hepcidin-2
EC number：
Alternative names：
Cleaved into：
GeneID：66438
Gene names (primary )：Hamp2
Gene names (synonym )：Hepc2
Gene names (ORF )：
Length：83
Mass：9410
Sequence：MALSTRTQAACLLLLLLASLSSTTYLQQQMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCEE
Tissue specificity：Highly expressed in the liver and to a much lesser extent in the heart. Also expressed in pancreas. {ECO:0000269|PubMed:12729891}.
Induction：
Developmental stage：
Protein families：Hepcidin family